Doodle

1,830 Coloring Pages of Pollinator

plantsflowerspollinator-friendlyperennialgardensanimalswildflowerinsectstropicalbiodiversity
Delphinium Trolliifolium or Columbian Larkspur from Larkspur
Orchid Lycaste Aromatica from Orchid
Disa Kewensis Orchid from Orchid
Chrysanthemum 1 from Perennial
Pollinators of Alaska from Nps
Black Elderberry from Elderberry
Iris Motif from Iris
Double Delight Hybrid Tea Rose from Roses
Iris Flower Blossom from Iris
Orchids from Orchid
Larkspur Flower from Larkspur
Hemerocallis Spp or Day Lily from Perennial
Caterpillar and Buttefly from Caterpillar
Black Orchid from Orchid
Anethum graveolens or Dill from Herb
Common Buttercup Flower from Buttercup
Rhododendron Calendulaceum or Flame Azalea from Azalea
Europeana Floribunda Rose from Roses
Ipomoea Tuberosa Hawaiian Woodrose from Roses
Flower Poppy from Red
Steampunk Bee from Steampunk animals coloring book
Bee from Cartoon animals v coloring book
Cosmos Scabiosoides from Cosmos
Butterfly from Cartoon animals viii coloring book
Bumblebee from Woodland animals
Swallow Tail Hummingbird from Hummingbirds
Apple Blossom Branch from Apple tree
Fireweed or Rosebay Willowherb from Celebrating wildflowers coloring book
Annual Hibiscus (Abelmoschus Moschatus) from Hawaii flower
Daffodil from Daffodil
American Twinflower from Celebrating wildflowers coloring book
Bumblebee from Simple objects coloring book
Bumblebee from Bumblebee
Ladybug from Cartoon animals viii coloring book
Realistic Ruby Throated Hummingbird from Hummingbirds
Ladybug from Cartoon animals v coloring book
Realistic Sunflowers from Sunflower
Daisy from Simple objects iv coloring book
Common Fruit Bats from Realistic animals coloring book
Black Raspberry from Celebrating wildflowers coloring book
Bee from Cartoon animals viii coloring book
Bug from Animals
Chinese Peony from Flowers
Heliconia Indica from Heliconia
Hibiscus Flower from Hawaii flower
Spring Crocus from Crocus
Butterfly from Cartoon animals vii coloring book
Hibiscus from Realistic flowers
Cherokee Rose from Roses
Hummingbird from Cartoon animals ii coloring book
Ladybug from Cartoon animals coloring book
Butterfly from Cartoon animals coloring book
Saskatoon from Serviceberry
Masdevallia Coccinea Orchid from Orchid
Grasshopper on the Flower from Grasshoppers
Renanthera Imschootiana Orchid from Orchid
Hyacinth Flower from Hyacinthus
Rabbit Smelling Tulip from Grass
Common Evening Primrose or Evening Star from Primrose
Tropical Vanda Tricolor Orchid from Orchid
Cornflower from Cornflowers
Grasshopper on Flower from Grasshoppers
Sundowner Rosa Grandiflora from Roses
Sophronitis Cernua Orchid from Orchid
Grasshopper in Garden from Grasshoppers
Aster 1 from Asters
ʻIʻiwi - Hawaiian Honeycreeper from Hawaii
Aquilegia Truncata Red Columbine from Columbine
Viola Adunca or Pale Mountain Violet from Violet
Schlumbergera Bloom from Cactus
Clarkia Amoena Farewell to Spring from Godetia
Dianthus Caryophyllus Clove Pink Carnation from Carnation
Oriental poppy from Perennial
Cochlospermum Vitifolium or Buttercup Tree from Buttercup
Daffodil Flowers from Daffodil
Cirsium Vulgare or Bull Thistle from Thistle
Bluebell Bellflower from Bellflower
Aster or Star Plant from Asters
Heliconia Psittacorum from Heliconia
Ranunculus Acris from Buttercup
Tall Mountain Bluebells from Celebrating wildflowers coloring book
Cornflower, Blue Bottle from Cornflowers
Cute Butterfly Flies over the Swamp from Cute butterflies coloring book
Burke's Larkspur from Celebrating wildflowers coloring book
Chinese Bellflower (Platycodon Grandiflorus) from Bellflower
Scarlet Carnation from Carnation
Butterfly Flies On A Flower from Flowers
Western Blue Flax from Celebrating wildflowers coloring book
Horse Chestnut from Chestnut
Cherry Jam Jar from Cherry
Nettle-leaved Bellflower from Bellflower
Meadow Buttercup, Ranunculus Acris from Buttercup
Honey Bee from Woodland animals
Marigold from Beautiful flowers coloring book
Anemone flower from Anemone
Butterflies and Flowers on a Meadow from Summer
Watering Can with Flowers from Watering can
Black Locust from Locust tree
Yellow Edged Giant Owl Butterfly from Butterfly
Giant Red Indian Paintbrush from Celebrating wildflowers coloring book
201 - 300 of 1,830 Next page
/ 19